HPA031185

antibody from Atlas Antibodies

Targeting: LGALS4 GAL4

Antibody data

Submit

Validation data

Product number: HPA031185 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031185, RRID:AB_2673777
Product name: Anti-LGALS4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHM KRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNT LQG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

LGALS4 protein structure - HPA031185 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human colon and liver tissues using Anti-LGALS4 antibody. Corresponding LGALS4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and rectum using Anti-LGALS4 antibody HPA031185 (A) shows similar protein distribution across tissues to independent antibody HPA031184 (B).
Antibody #2 product nr: HPA031184, HPA031186
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-LGALS4 antibody HPA031185.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum using Anti-LGALS4 antibody HPA031185.
Sample type: HUMAN