HPA014600

MARCH1 antibody from Sigma-Aldrich
FLJ20668, MARCH-I, RNF171
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014600, RRID:AB_1853573
Product name
Anti-MARCH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014600
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase MARCH1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSC
NVNTDIKDAVVVPVPQTGANSLPSAEGG
Storage
-20C
Provider Type Product Number
- No reagents -