Antibody data

Product number
ABIN784716
Provider
antibodies-online
Product name
anti-Homeobox B1 (HOXB1) (C-Term) antibody
Provider product page
antibodies-online - ABIN784716
Antibody type
Polyclonal
Antigen
The immunogen for anti-Hoxb1 antibody: synthetic peptide corresponding to a region of Mouse
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
ETQVKIWFQNRRMKQKKREREGGRMPAGPPGCPKE
AAGDA SDQSACTSPE
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -