HPA015988

C1orf27 antibody from Sigma-Aldrich
FLJ20505, odr-4, TTG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015988
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015988, RRID:AB_1845644
Product name
Anti-C1orf27 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015988
Antibody type
Polyclonal
Antigen
Protein odr-4 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDH
FMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASL
DNTDDEQPKQPIK
Storage
-20C
Provider Type Product Number
- No reagents -