HPA014597

MARCH8 antibody from Sigma-Aldrich
c-MIR, CMIR, MARCH-VIII, MIR, RNF178
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014597
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014597, RRID:AB_1853580
Product name
Anti-MARCH8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014597
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase MARCH8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFE
KSPLTEPNFENKHGHGICHSDTNSSCCTEPEDTGA
EIIHV
Storage
-20C
Provider Type Product Number
- No reagents -