H00010293-M01

TRAIP antibody from Abnova Corporation
RNF206, TRIP
No application information provided.

Antibody data

Product number
H00010293-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010293-M01, RRID:AB_1581531
Product name
TRAIP monoclonal antibody (M01), clone 2E7
Provider product page
Abnova Corporation - H00010293-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TRAIP.
Antigen sequence
GQSCAGEPDEELVGAFPIFVRNAILGQKQPKRPRS
ESSCSKDVVRTGFDGLGGRTKFIQPTDTVMIRPLP
VKPKTKVKQRVRVKTVPSLFQAKLDTFLWS
Isotype
IgG
Antibody clone number
2E7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -