ABIN630353

antibody from antibodies-online

Targeting: CYP2B6 CPB6, CYP2B, CYPIIB6

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630353 - Provider product page
Provider: antibodies-online
Product name: anti-Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6) antibody
Antibody type: Polyclonal
Antigen: P450 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT
Description: Purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

CYP2B6 protein structure - ABIN630353 shown in red.