H00051364-M05

ZMYND10 antibody from Abnova Corporation
BLU, CILD22, DNAAF7

Antibody data

Product number
H00051364-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051364-M05, RRID:AB_1582045
Product name
ZMYND10 monoclonal antibody (M05), clone 3A6
Provider product page
Abnova Corporation - H00051364-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ZMYND10.
Antigen sequence
MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQ
HENLEKLNMQAILDATVSQGEPIQELLVTHGKVPT
LVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYM
VVHHEASIINLLETVFFHKEVCESAEDTVLDLVDY
CHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQ
AELMEFEIALKALSVLRYITDCVDSLSLSTLSRML
STHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWH
TVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYC
LTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLA
HLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQ
AIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLE
AVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQV
KHWEKHGKTCVLAAQGDRAK
Isotype
IgG
Antibody clone number
3A6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -