Antibody data

Product number
ABIN502954
Provider
antibodies-online
Product name
anti-Glutathione S-Transferase alpha 3 (GSTA3) antibody
Provider product page
antibodies-online - ABIN502954
Antibody type
Polyclonal
Antigen
The immunogen for anti-GSTA3 antibody: synthetic peptide directed towards the middle region of human GSTA3
Reactivity
Human
Host
Rabbit
Antigen sequence
SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKP
PADAK ALEEARKIFR
Vial size
50 µg
Provider Type Product Number
- No reagents -