H00004215-M10

MAP3K3 antibody from Abnova Corporation
MAPKKK3, MEKK3
No application information provided.

Antibody data

Product number
H00004215-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004215-M10, RRID:AB_1137293
Product name
MAP3K3 monoclonal antibody (M10), clone 1H3
Provider product page
Abnova Corporation - H00004215-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAP3K3.
Antigen sequence
MNEANVMLPYSGKEEPVLPVAMTLPLPGRGPRCGT
AATEGGSSFVNAVVSVLQVGVTLMLYPVSKLETVC
ALWALSTPALGLGLGCIEK
Isotype
IgG
Antibody clone number
1H3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -