Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003146-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003146-M08, RRID:AB_518856
- Product name
- HMGB1 monoclonal antibody (M08), clone 2F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HMGB1.
- Antigen sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDAS
VNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR
YEREMKTYIPPKGETKKKFK- Isotype
- IgG
- Antibody clone number
- 2F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The anti-inflammatory activity of HMGB1 A box is enhanced when fused with C-terminal acidic tail.
Functional dissection of an IFN-alpha/beta receptor 1 promoter variant that confers higher risk to chronic hepatitis B virus infection.
Gong W, Zheng Y, Chao F, Li Y, Xu Z, Huang G, Gao X, Li S, He F
Journal of biomedicine & biotechnology 2010;2010:915234
Journal of biomedicine & biotechnology 2010;2010:915234
Functional dissection of an IFN-alpha/beta receptor 1 promoter variant that confers higher risk to chronic hepatitis B virus infection.
Zhou J, Huang JD, Poon VK, Chen DQ, Chan CC, Ng F, Guan XY, Watt RM, Lu L, Yuen KY, Zheng BJ
Journal of hepatology 2009 Aug;51(2):322-32
Journal of hepatology 2009 Aug;51(2):322-32
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HMGB1 monoclonal antibody (M08), clone 2F6 Western Blot analysis of HMGB1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M08), clone 2F6.Lane 1: HMGB1 transfected lysate(25 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HMGB1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
