Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404953 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tripartite Motif Containing 8 (TRIM8) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRIM8 antibody: synthetic peptide directed towards the middle region of human TRIM8
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
QSVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSG
PVGGQ YGAAGTASGE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular classification of nodal metastasis in primary larynx squamous cell carcinoma.
Carinci F, Arcelli D, Lo Muzio L, Francioso F, Valentini D, Evangelisti R, Volinia S, D'Angelo A, Meroni G, Zollo M, Pastore A, Ionna F, Mastrangelo F, Conti P, Tetè S
Translational research : the journal of laboratory and clinical medicine 2007 Oct;150(4):233-45
Translational research : the journal of laboratory and clinical medicine 2007 Oct;150(4):233-45
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting