Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183941 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Eukaryotic Translation Initiation Factor 4A2 (EIF4A2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EIF4A2 antibody: synthetic peptide directed towards the N terminal of human EIF4A2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNF
DDMNL KESLLRGIYA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Sphingosine kinase 1 is required for migration, proliferation and survival of MCF-7 human breast cancer cells.
Upregulation of human mitochondrial NADH dehydrogenase subunit 5 in intestinal epithelial cells is modulated by Vibrio cholerae pathogenesis.
Sarkar S, Maceyka M, Hait NC, Paugh SW, Sankala H, Milstien S, Spiegel S
FEBS letters 2005 Oct 10;579(24):5313-7
FEBS letters 2005 Oct 10;579(24):5313-7
Upregulation of human mitochondrial NADH dehydrogenase subunit 5 in intestinal epithelial cells is modulated by Vibrio cholerae pathogenesis.
Sarkar M, Das S, Bandyopadhaya A, Ray K, Chaudhuri K
FEBS letters 2005 Jun 20;579(16):3449-60
FEBS letters 2005 Jun 20;579(16):3449-60
No comments: Submit comment
No validations: Submit validation data