Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310925 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Proliferation-Associated 2G4, 38kDa (PA2G4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PA2G4 antibody: synthetic peptide directed towards the middle region of human PA2G4
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
NCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKD
HEKAE FEVHEVYAVD- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The ErbB3-binding protein Ebp1 suppresses androgen receptor-mediated gene transcription and tumorigenesis of prostate cancer cells.
Zhang Y, Wang XW, Jelovac D, Nakanishi T, Yu MH, Akinmade D, Goloubeva O, Ross DD, Brodie A, Hamburger AW
Proceedings of the National Academy of Sciences of the United States of America 2005 Jul 12;102(28):9890-5
Proceedings of the National Academy of Sciences of the United States of America 2005 Jul 12;102(28):9890-5
No comments: Submit comment
No validations: Submit validation data