HPA023959

XPO5 antibody from Sigma-Aldrich
KIAA1291
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023959
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023959, RRID:AB_1848331
Product name
Anti-XPO5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023959
Antibody type
Polyclonal
Antigen
Exportin-5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDS
LDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGK
PLGEQFRKEVH
Storage
-20C
Provider Type Product Number
- No reagents -