HPA026948

MPHOSPH6 antibody from Sigma-Aldrich
MPP6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026948
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026948, RRID:AB_1854077
Product name
Anti-MPHOSPH6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026948
Antibody type
Polyclonal
Antigen
M-phase phosphoprotein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEK
ESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLML
QMNAKHKAEEVEDETVELDVSDEEMARRYETLVGT
IGKKFARKRDHANYEEDENGDITPIKAKKM
Storage
-20C
Provider Type Product Number
- No reagents -