Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501973 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the N terminal of human PRKRA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTP
IQVLH EYGMKTKNIP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human TRBP and PACT directly interact with each other and associate with dicer to facilitate the production of small interfering RNA.
Kok KH, Ng MH, Ching YP, Jin DY
The Journal of biological chemistry 2007 Jun 15;282(24):17649-57
The Journal of biological chemistry 2007 Jun 15;282(24):17649-57
No comments: Submit comment
No validations: Submit validation data