Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010644-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010644-A01, RRID:AB_529840
- Product name
- IMP-2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant IMP-2.
- Antigen sequence
HGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLD
GLLAQYGTVENVEQVNTDTETAVVNVTYATREEAK
IAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
Role of the RNA-binding protein IMP-2 in muscle cell motility.
Rivera Vargas T, Boudoukha S, Simon A, Souidi M, Cuvellier S, Pinna G, Polesskaya A
Oncogene 2014 May 29;33(22):2866-75
Oncogene 2014 May 29;33(22):2866-75
Role of the RNA-binding protein IMP-2 in muscle cell motility.
Boudoukha S, Cuvellier S, Polesskaya A
Molecular and cellular biology 2010 Dec;30(24):5710-25
Molecular and cellular biology 2010 Dec;30(24):5710-25
No comments: Submit comment
No validations: Submit validation data