SAB1400230

PYY antibody from Sigma-Aldrich
PYY1
ELISA
Recommended by provider

Antibody data

Product number
SAB1400230
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400230, RRID:AB_1855195
Product name
Anti-PYY antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1400230
Antibody type
Polyclonal
Antigen
PYY (AAH41057.1, a.a. 1-97) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEA
PGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGP
DRLLSKTFFPDGEDRPVRSRSEGPDLW (withou
t GST)
Storage
-20C
Provider Type Product Number
- No reagents -