HPA020108

PAEP antibody from Sigma-Aldrich
GD, GdA, GdF, GdS, MGC138509, MGC142288, PAEG, PEP, PP14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020108
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020108, RRID:AB_1855595
Product name
Anti-PAEP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020108
Antibody type
Polyclonal
Antigen
Glycodelin Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMC
QYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLK
QME
Storage
-20C
Provider Type Product Number
- No reagents -