Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183618 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Menage A Trois Homolog 1, Cyclin H Assembly Factor (Xenopus Laevis) (MNAT1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MNAT1 antibody: synthetic peptide directed towards the C terminal of human MNAT1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAG
GYTSS LACHRALQDA- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
Zhou M, Deng L, Kashanchi F, Brady JN, Shatkin AJ, Kumar A
Proceedings of the National Academy of Sciences of the United States of America 2003 Oct 28;100(22):12666-71
Proceedings of the National Academy of Sciences of the United States of America 2003 Oct 28;100(22):12666-71
No comments: Submit comment
No validations: Submit validation data