Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487305 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Menage A Trois Homolog 1, Cyclin H Assembly Factor (Xenopus Laevis) (MNAT1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MNAT1 antibody: synthetic peptide directed towards the N terminal of human MNAT1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVD
LLFVR GAGNCPECGT- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Polymorphisms of CAK genes and risk for lung cancer: a case-control study in Chinese population.
Li Y, Jin G, Wang H, Liu H, Qian J, Gu S, Ma H, Miao R, Hu Z, Sun W, Wang Y, Jin L, Wei Q, Shen H, Huang W, Lu D
Lung cancer (Amsterdam, Netherlands) 2007 Nov;58(2):171-83
Lung cancer (Amsterdam, Netherlands) 2007 Nov;58(2):171-83
No comments: Submit comment
No validations: Submit validation data