Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183609 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GATA Binding Protein 4 (GATA4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GATA4 antibody: synthetic peptide directed towards the N terminal of human GATA4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASS
PVYVP TPRVPSSVLG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references High GATA-4 expression associates with aggressive behavior, whereas low anti-Müllerian hormone expression associates with growth potential of ovarian granulosa cell tumors.
Anttonen M, Unkila-Kallio L, Leminen A, Butzow R, Heikinheimo M
The Journal of clinical endocrinology and metabolism 2005 Dec;90(12):6529-35
The Journal of clinical endocrinology and metabolism 2005 Dec;90(12):6529-35
No comments: Submit comment
No validations: Submit validation data