H00005728-M13

PTEN antibody from Abnova Corporation
BZS, MHAM, MMAC1, PTEN1, TEP1

Antibody data

Product number
H00005728-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005728-M13, RRID:AB_1579308
Product name
PTEN monoclonal antibody (M13), clone 1C3
Provider product page
Abnova Corporation - H00005728-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PTEN.
Antigen sequence
TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMG
FPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLC
AERHYDTAKFNCRVAQYPFE
Isotype
IgG
Antibody clone number
1C3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -