Antibody data

Product number
H00007371-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007371-M03, RRID:AB_1137069
Product name
UCK2 monoclonal antibody (M03), clone 1G12
Provider product page
Abnova Corporation - H00007371-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant UCK2.
Antigen sequence
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSS
VCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTS
EQKAKALKGQFNFDHPDAFDNELILKTPKEITEGK
TVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAF
YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERG
RDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR
GADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGY
TPSRKR*ASESSSRPH
Isotype
IgG
Antibody clone number
1G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -