Antibody data

Product number
H00004653-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004653-M02, RRID:AB_1136967
Product name
MYOC monoclonal antibody (M02), clone 2B4
Provider product page
Abnova Corporation - H00004653-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MYOC.
Antigen sequence
MRFFCARCCSFGPEMPAVQLLLLACLVWDVGARTA
QLRKANDQSGRCQYTFSVASPNESSCPEQSQAMSV
IHNLQRDSSTQRLDLEATKARLSSLESLLHQLTLD
QAARPQETQEGLQRELGTLRRERDQLETQTRELET
AYSNLLRDKSVLEEEKKRLRQENENLARRLESSSQ
EVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTL
AFQELKSELTEVPASRILKESPSGYLRSGEGDTGC
GELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPY
TQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKV
HILPRPLESTGAVVYSGSLYFQGAESRTVIRYELN
TETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDE
AGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETN
IRKQSVANAFIICGTLYTVSSYTSADATVNFAYDT
GTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWD
NLNMVTYDIKLSKM
Isotype
IgG
Antibody clone number
2B4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -