Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503495 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Angiotensin I Converting Enzyme (Peptidyl-Dipeptidase A) 2 (ACE2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACE2 antibody: synthetic peptide directed towards the middle region of human ACE2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLN
DNSLE FLGIQPTLGP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Modulation of TNF-alpha-converting enzyme by the spike protein of SARS-CoV and ACE2 induces TNF-alpha production and facilitates viral entry.
Haga S, Yamamoto N, Nakai-Murakami C, Osawa Y, Tokunaga K, Sata T, Yamamoto N, Sasazuki T, Ishizaka Y
Proceedings of the National Academy of Sciences of the United States of America 2008 Jun 3;105(22):7809-14
Proceedings of the National Academy of Sciences of the United States of America 2008 Jun 3;105(22):7809-14
No comments: Submit comment
No validations: Submit validation data