HPA019475

FAM188B antibody from Sigma-Aldrich
C7orf67, FLJ22374
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019475
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019475, RRID:AB_1848806
Product name
Anti-C7orf67 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019475
Antibody type
Polyclonal
Antigen
UPF0526 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTLVNIYDLSDEDAGWRTSLSETSKARHDNLDGDV
LGNFVSSKRPPHKSKPMQTVPGETPVLTSAWEKID
KLHSEPSLDVKRMGENSRPKSGLIV
Storage
-20C
Provider Type Product Number
- No reagents -