Antibody data

Product number
H00080303-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00080303-M11, RRID:AB_1204302
Product name
EFHD1 monoclonal antibody (M11), clone 3D10
Provider product page
Abnova Corporation - H00080303-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EFHD1.
Antigen sequence
GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSA
SKFEAELKAEQDERKREEEERRLRQAAFQKLKANF
N
Isotype
IgG
Antibody clone number
3D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -