Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00080303-M11 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00080303-M11, RRID:AB_1204302
- Product name
- EFHD1 monoclonal antibody (M11), clone 3D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EFHD1.
- Antigen sequence
GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSA
SKFEAELKAEQDERKREEEERRLRQAAFQKLKANF
N- Isotype
- IgG
- Antibody clone number
- 3D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of EFHD1 expression in transfected 293T cell line by EFHD1 monoclonal antibody (M11), clone 3D10.Lane 1: EFHD1 transfected lysate(27 KDa).Lane 2: Non-transfected lysate.