HPA000896

CXorf57 antibody from Sigma-Aldrich
FLJ10178, FLJ14191
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000896
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000896, RRID:AB_1078880
Product name
Anti-CXorf57 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000896
Antibody type
Polyclonal
Antigen
Uncharacterized protein CXorf57 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TISDRWESQLWREKKFGLIDHLHYSRVYPESIPRK
FMFEHRKFLSDQYNSQPAKYVPPEGRPPKLDDFKS
ARSLGHFEVTILGLNHEIAIDVAFLPMYCPEDIRT
SQIDTLLTSMNY
Storage
-20C
Provider Type Product Number
- No reagents -