HPA022905

SEPT4 antibody from Sigma-Aldrich
ARTS, CE5B3, H5, hCDCREL-2, hucep-7, MART, PNUTL2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022905
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022905, RRID:AB_1856687
Product name
Anti-SEPT4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022905
Antibody type
Polyclonal
Antigen
Septin-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLV
VKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIR
EKDEELRRMQE
Storage
-20C
Provider Type Product Number
- No reagents -