Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1805428 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Calcitonin-Related Polypeptide alpha (CALCA) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic human Calcitonin, BSA-conjugated(CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP). Percent identity by BLAST analysis: Human, Gorilla, Monkey (100 %), Rat, Hamster (94 %), Mouse, Panda, Dog, Horse (90 %).
- Description
- Unpurified serum
- Reactivity
- Human
- Host
- Rabbit
- Vial size
- 20 μL
- Storage
- Lyophilized powder may be stored at 4°C for short-term only.
- Handling
- Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data