Antibody data

Product number
H00000280-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000280-M01, RRID:AB_1571181
Product name
AMY2B monoclonal antibody (M01), clone 2B12
Provider product page
Abnova Corporation - H00000280-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AMY2B.
Antigen sequence
PNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFG
GVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRS
GNEDEFRNMVTRCNNVGVRIYVDAVINHM
Isotype
IgG
Antibody clone number
2B12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -