HPA018803

DES antibody from Sigma-Aldrich
CMD1I, CSM1, CSM2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018803
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018803, RRID:AB_1847616
Product name
Anti-DES antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018803
Antibody type
Polyclonal
Antigen
Desmin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVH
TKKTVMIKTIETRDGEVVSEATQQQHEVL
Storage
-20C
Provider Type Product Number
- No reagents -