Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310423 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RING Finger Protein 6 (RNF6) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNF6 antibody: synthetic peptide directed towards the C terminal of human RNF6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQID
NLSTR HYEHNSIDSE- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The ubiquitin ligase Rnf6 regulates local LIM kinase 1 levels in axonal growth cones.
Tursun B, Schlüter A, Peters MA, Viehweger B, Ostendorff HP, Soosairajah J, Drung A, Bossenz M, Johnsen SA, Schweizer M, Bernard O, Bach I
Genes & development 2005 Oct 1;19(19):2307-19
Genes & development 2005 Oct 1;19(19):2307-19
No comments: Submit comment
No validations: Submit validation data