Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503038 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-UDP Glucuronosyltransferase 1 Family, Polypeptide A7 (UGT1A7) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSL
LTSSS NGIFDLFFSN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Gilbert's Syndrome and irinotecan toxicity: combination with UDP-glucuronosyltransferase 1A7 variants increases risk.
Lankisch TO, Schulz C, Zwingers T, Erichsen TJ, Manns MP, Heinemann V, Strassburg CP
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2008 Mar;17(3):695-701
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2008 Mar;17(3):695-701
No comments: Submit comment
No validations: Submit validation data