Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184347 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Jun Proto-Oncogene (JUN) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-JUNB antibody: synthetic peptide directed towards the C terminal of human JUNB
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKR
LRNRL AATKCRKRKL- Vial size
- 0.1 mg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Constitutive expression of the AP-1 transcription factors c-jun, junD, junB, and c-fos and the marginal zone B-cell transcription factor Notch2 in splenic marginal zone lymphoma.
Trøen G, Nygaard V, Jenssen TK, Ikonomou IM, Tierens A, Matutes E, Gruszka-Westwood A, Catovsky D, Myklebost O, Lauritzsen G, Hovig E, Delabie J
The Journal of molecular diagnostics : JMD 2004 Nov;6(4):297-307
The Journal of molecular diagnostics : JMD 2004 Nov;6(4):297-307
No comments: Submit comment
No validations: Submit validation data