Explore
Validate
LearnH00006198-M02
antibody from Abnova Corporation
Targeting: RPS6KB1
p70(S6K)-alpha, PS6K, S6K, S6K1, STK14A
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006198-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006198-M02, RRID:AB_519026
- Product name
- RPS6KB1 monoclonal antibody (M02), clone 1E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RPS6KB1.
- Antigen sequence
PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVK
FSPGDFWGRGASASTANPQTPVEYPMETSGIEQMD
VTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEH
LRMNL- Isotype
- IgG
- Antibody clone number
- 1E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RPS6KB1 monoclonal antibody (M02), clone 1E10 Western Blot analysis of RPS6KB1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 60 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between STK11 and RPS6KB1. HeLa cells were stained with anti-STK11 rabbit purified polyclonal 1:1200 and anti-RPS6KB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
