Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004690-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004690-M01, RRID:AB_463964
- Product name
- NCK1 monoclonal antibody (M01), clone 1A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NCK1.
- Antigen sequence
NLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDV
IEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNP
LTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTR
HQAEM- Isotype
- IgG
- Antibody clone number
- 1A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NCK1 monoclonal antibody (M01), clone 1A1 Western Blot analysis of NCK1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NCK1 expression in transfected 293T cell line by NCK1 monoclonal antibody (M01), clone 1A1.Lane 1: NCK1 transfected lysate(42.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NCK1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol