Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501930 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Actin, beta (ACTB) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYD ESGPSIVHRK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes.
Rinne T, Clements SE, Lamme E, Duijf PH, Bolat E, Meijer R, Scheffer H, Rosser E, Tan TY, McGrath JA, Schalkwijk J, Brunner HG, Zhou H, van Bokhoven H
Human molecular genetics 2008 Jul 1;17(13):1968-77
Human molecular genetics 2008 Jul 1;17(13):1968-77
No comments: Submit comment
No validations: Submit validation data