Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309591 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DNA Fragmentation Factor, 45kDa, alpha Polypeptide (DFFA) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DFFA antibody: synthetic peptide directed towards the N terminal of human DFFA
- Description
- Protein A purified
- Reactivity
- Human, Rat
- Host
- Rabbit
- Antigen sequence
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVA
ASCLE DLRSKACDIL- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A unique role of the DNA fragmentation factor in maintaining genomic stability.
The wheat and barley vernalization gene VRN3 is an orthologue of FT.
Yan B, Wang H, Peng Y, Hu Y, Wang H, Zhang X, Chen Q, Bedford JS, Dewhirst MW, Li CY
Proceedings of the National Academy of Sciences of the United States of America 2006 Jan 31;103(5):1504-9
Proceedings of the National Academy of Sciences of the United States of America 2006 Jan 31;103(5):1504-9
The wheat and barley vernalization gene VRN3 is an orthologue of FT.
Yan L, Fu D, Li C, Blechl A, Tranquilli G, Bonafede M, Sanchez A, Valarik M, Yasuda S, Dubcovsky J
Proceedings of the National Academy of Sciences of the United States of America 2006 Dec 19;103(51):19581-6
Proceedings of the National Academy of Sciences of the United States of America 2006 Dec 19;103(51):19581-6
No comments: Submit comment
No validations: Submit validation data