ABIN630280

antibody from antibodies-online

Targeting: SPP1 BNSP, BSPI, ETA-1, OPN

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630280 - Provider product page
Provider: antibodies-online
Product name: anti-Secreted phosphoprotein 1 (SPP1) antibody
Antibody type: Polyclonal
Antigen: SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASS
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

SPP1 protein structure - ABIN630280 shown in red.