Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001280-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001280-M01, RRID:AB_425374
- Product name
- COL2A1 monoclonal antibody (M01), clone 3H1-F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant COL2A1.
- Antigen sequence
MSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAE
VDATLKSLNNQIESIRSPEGSRKNPARTCRDLKLC
HPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCV
YPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHF
SYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCK
NSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRF
TYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIID
IAPMDIGGPEQEFGVDIGPVCFL- Isotype
- IgG
- Antibody clone number
- 3H1-F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The effect of platelet lysate supplementation of a dextran-based hydrogel on cartilage formation.
Raman microspectroscopy: a noninvasive analysis tool for monitoring of collagen-containing extracellular matrix formation in a medium-throughput culture system.
Synthesis and characterization of hyaluronic acid-poly(ethylene glycol) hydrogels via Michael addition: An injectable biomaterial for cartilage repair.
Enzymatically crosslinked dextran-tyramine hydrogels as injectable scaffolds for cartilage tissue engineering.
Moreira Teixeira LS, Leijten JC, Wennink JW, Chatterjea AG, Feijen J, van Blitterswijk CA, Dijkstra PJ, Karperien M
Biomaterials 2012 May;33(14):3651-61
Biomaterials 2012 May;33(14):3651-61
Raman microspectroscopy: a noninvasive analysis tool for monitoring of collagen-containing extracellular matrix formation in a medium-throughput culture system.
Kunstar A, Otto C, Karperien M, van Blitterswijk C, van Apeldoorn A
Tissue engineering. Part C, Methods 2011 Jul;17(7):737-44
Tissue engineering. Part C, Methods 2011 Jul;17(7):737-44
Synthesis and characterization of hyaluronic acid-poly(ethylene glycol) hydrogels via Michael addition: An injectable biomaterial for cartilage repair.
Jin R, Moreira Teixeira LS, Krouwels A, Dijkstra PJ, van Blitterswijk CA, Karperien M, Feijen J
Acta biomaterialia 2010 Jun;6(6):1968-77
Acta biomaterialia 2010 Jun;6(6):1968-77
Enzymatically crosslinked dextran-tyramine hydrogels as injectable scaffolds for cartilage tissue engineering.
Jin R, Moreira Teixeira LS, Dijkstra PJ, Zhong Z, van Blitterswijk CA, Karperien M, Feijen J
Tissue engineering. Part A 2010 Aug;16(8):2429-40
Tissue engineering. Part A 2010 Aug;16(8):2429-40
No comments: Submit comment
No validations: Submit validation data