Antibody data

Product number
H00002168-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002168-M02A, RRID:AB_1204333
Product name
FABP1 monoclonal antibody (M02A), clone 5F7
Provider product page
Abnova Corporation - H00002168-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FABP1.
Antigen sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDI
KGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE
LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELN
GDIITNTMTLGDIVFKRISKRI
Isotype
IgM
Antibody clone number
5F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -