ABIN309949
antibody from antibodies-online
Targeting: DIDO1
BYE1, C20orf158, DATF1, DIO-1, DIO1, dJ885L7.8, FLJ11265, KIAA0333
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309949 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Death Inducer-Obliterator 1 (DIDO1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DIDO1 antibody: synthetic peptide directed towards the C terminal of human DIDO1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KKAVVVPARSEALGKEAACESSTPSWASDHNYNAV
KPEKT AAPSPSLLYK- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Dido disruption leads to centrosome amplification and mitotic checkpoint defects compromising chromosome stability.
Trachana V, van Wely KH, Guerrero AA, Fütterer A, Martínez-A C
Proceedings of the National Academy of Sciences of the United States of America 2007 Feb 20;104(8):2691-6
Proceedings of the National Academy of Sciences of the United States of America 2007 Feb 20;104(8):2691-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting