Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005599-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005599-M07, RRID:AB_1137297
- Product name
- MAPK8 monoclonal antibody (M07), clone 4H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAPK8.
- Antigen sequence
HPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEW
KELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGS
QHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGP
LGCCR- Isotype
- IgG
- Antibody clone number
- 4H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MAPK8 expression in transfected 293T cell line by MAPK8 monoclonal antibody (M07), clone 4H6.Lane 1: MAPK8 transfected lysate(48.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of MAPK8 transfected lysate using anti-MAPK8 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAPK8 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol