Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1544408 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin 13 Receptor, alpha 1 (IL13RA1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for Anti-IL13RA1 antibody is: synthetic peptide directed towards the N-terminal region of IL13RA1
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQ
DKKIA PETRRSIEVP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-IL13RA1 AntibodyTitration: 1.0 μg/mL Positive Control: Fetal kidney
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Sample Type: Lane 1:641 μg mouse CT26 lysate Lane 2: 041 μg mouse MC38 lysate Primary Antibody Dilution: 1:0000Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:0000 Color/Signal Descriptions: IL13RA1 Gene Name: Miranda A. Hallett, Vanderbilt University Medical Center Submitted by: