HPA050250

MORC4 antibody from Atlas Antibodies
FLJ11565, ZCW4, ZCWCC2

Antibody data

Product number
HPA050250
Provider
Atlas Antibodies
Product name
Anti-MORC4
Provider product page
Atlas Antibodies - HPA050250
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRL
QNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDK
SSSERSTPPYLFPEYPEASKNTGQNREVSILYPGA
KDQRQGSLLPEELEDQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -