HPA026477

TCAP antibody from Sigma-Aldrich
CMD1N, LGMD2G, T-cap, TELE, telethonin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026477
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026477, RRID:AB_1857888
Product name
Anti-TCAP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026477
Antibody type
Polyclonal
Antigen
Telethonin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHE
EDTQRHETYHQQGQCQVLVQRSPWLMMRMGILGRG
LPEYQ
Storage
-20C
Provider Type Product Number
- No reagents -