HPA027090

TUBD1 antibody from Sigma-Aldrich
FLJ12709, TUBD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027090
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027090, RRID:AB_1858457
Product name
Anti-TUBD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027090
Antibody type
Polyclonal
Antigen
Tubulin delta chain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDALLSDSHSSQGLCSMRENEAYQASCKERFFSEE
ENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYG
QHACFCQ
Storage
-20C
Provider Type Product Number
- No reagents -